PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03196.1.p
Common NameEUGRSUZ_K03196, LOC104426524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 463aa    MW: 50241.1 Da    PI: 9.8133
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03196.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.8e-33191246359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh 
  Eucgr.K03196.1.p 191 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHNHL 246
                       9***************************************.***************5 PP

2WRKY102.13.3e-32390447259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k ver+ edpk +++tYeg+Hnhe
  Eucgr.K03196.1.p 390 GDGFRWRKYGQKVVKGNPHPRSYYRCTSLKCSVRKYVERAMEDPKSFITTYEGKHNHE 447
                       5********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.3E-30179248IPR003657WRKY domain
SuperFamilySSF1182901.44E-25188248IPR003657WRKY domain
SMARTSM007745.0E-37189247IPR003657WRKY domain
PfamPF031061.3E-25191245IPR003657WRKY domain
PROSITE profilePS5081123.388191248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.6E-32381449IPR003657WRKY domain
PROSITE profilePS5081133.82384449IPR003657WRKY domain
SuperFamilySSF1182901.27E-27385449IPR003657WRKY domain
SMARTSM007744.2E-37389448IPR003657WRKY domain
PfamPF031062.6E-25391447IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
METKETERTV IAKPVASRPT FSTFRSFSEL LAGAINDSAP KVGSESGVAP IKPKTVRVKP  60
AVSRASAAMF SSQAEISGTA ICNSVDTLSN SDSQRTVLYK PLAKPVSKAV ASLLANIGNL  120
NATQPAIRPS EGPPPEKCHV KSKPSSNIRQ IIPRAAETKQ MSEPLKIAAQ DIEEDQRALP  180
STASVDRPSY DGYNWRKYGQ KQVKGSEYPR SYYKCTHPNC PVKKKVERSL DGQIAEIVYK  240
GEHNHLKPQP PKRSSSGMQG LGTIPDGTEQ DNSNQLRGSQ PGEKNEGSLG RVENQTEVGL  300
AANSSYQGKG LMVHDRAAAT EAVAPSGGTP DSSCNISGAE DGSKAKEVRN DERRSKRRRT  360
ESGASEAGIA TEGVQEPSTD RQNSTDEILG DGFRWRKYGQ KVVKGNPHPR SYYRCTSLKC  420
SVRKYVERAM EDPKSFITTY EGKHNHEMPL KTTSPADHQA NK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-29178449777Probable WRKY transcription factor 4
2lex_A4e-29178449777Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03196.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037907.10.0PREDICTED: WRKY transcription factor 44-like
RefseqXP_010037909.10.0PREDICTED: WRKY transcription factor 44-like
RefseqXP_010037910.10.0PREDICTED: WRKY transcription factor 44-like
TrEMBLA0A059A8J10.0A0A059A8J1_EUCGR; Uncharacterized protein
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.13e-91WRKY family protein